SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428224491|ref|YP_007108588.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224491|ref|YP_007108588.1|
Domain Number 1 Region: 8-146
Classification Level Classification E-value
Superfamily CheY-like 9.82e-43
Family CheY-related 0.00027
Further Details:      
 
Domain Number 2 Region: 148-323
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.71e-36
Family PDEase 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428224491|ref|YP_007108588.1|
Sequence length 349
Comment response regulator receiver modulated metal dependent phosphohydrolase [Geitlerinema sp. PCC 7407]
Sequence
MRFSQVSHLDPERPKVLVVDDHPSSRMTAVALLSVEGYDVLEADSGPAALLSVEKHNPDL
ILLDVMMPGMDGFEVCRQLKQDEKTRLIPIVFVTALNDRRARLKGIDVGGDDFLTKPFDQ
LELSARVKSLVRQKRLNEDLEHVEQVLFSIAQIVESRDPNTGDHCERLCGLGQSFGRYLN
LSRAEIRDLTWAGYLHDIGKVGVPDDVLLKRGKLTPEEWVVMKQHVLIGERICLPMRTMK
GVVPIIRHHHERWDGSGYPDGLSGNEIPRLAQIFQVLDIFDALTSERPYKKAFSFEEAIA
ILEEETHKGWRNPELVRQFSEFIQRAHQEGATFPQDDSFRRPDSMAVPR
Download sequence
Identical sequences K9S6E0
WP_015171103.1.54702 gi|428224491|ref|YP_007108588.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]