SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428224537|ref|YP_007108634.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224537|ref|YP_007108634.1|
Domain Number 1 Region: 4-69
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000255
Family 7-Fe ferredoxin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428224537|ref|YP_007108634.1|
Sequence length 74
Comment 4Fe-4S ferredoxin [Geitlerinema sp. PCC 7407]
Sequence
MAHTIVTNVCEGVADCVDACPVACIHEGPGKNTKGTDWYWIDFSTCIDCGICLQVCPVEG
AILPEERPDLQQTP
Download sequence
Identical sequences K9S4M9
WP_015171149.1.54702 gi|428224537|ref|YP_007108634.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]