SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428224649|ref|YP_007108746.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224649|ref|YP_007108746.1|
Domain Number 1 Region: 1-577
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 5.23e-185
Family Prokaryotic type I DNA topoisomerase 0.0000000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428224649|ref|YP_007108746.1|
Sequence length 902
Comment DNA topoisomerase I [Geitlerinema sp. PCC 7407]
Sequence
MSTLVIVESPTKARTIRNYLPQGYRVEASMGHVRDLPQSASEIPGEIKGERWAQLGVNVD
GDFEPIYVVPKDKKKVVKELKDALKGVDELILATDEDREGESISWHLLQILNPKVPIKRM
VFHEITEDAIRAALKNCRTVNDQLVRAQETRRILDRLVGYTLSPLLWKKIAWGLSAGRVQ
SVAVRLLVRRERQRRAFRKGAYWDLKATLAKAKNAFEAKLVSLGGTRLATGSDFDPDTGQ
ILAGREVVLLNETEAIALRERLQDKPWTVASIDERPSTRKPSPPFTTSTLQQEANRKLRL
SAQETMRTAQSLYEQGYITYMRTDSVHLSQQAIAAARDCVEHKYGPEYLSPEPRQYATKS
KGAQEAHEAIRPAGSRFRTPQETGLSGRELSLYDLIWKRTVATQMAEARQTHITVNIEVE
DAVFRASGKRIDFPGFFRAYVEGSDDPDAAIEDQEVILPNLKKGDQPTCKALEAIAHETQ
PPARYTEASLVKTLESEGIGRPSTYASIISTIIDRGYAQLVSNALVPTFTAFAVTSLLEK
SFPDLVDTSFTARMERTLDEISMGDVEWLPYLRQFYCGDSGLENQVKTREDQIDPNEART
VELDNITDAKIRIGRFGPYIEAENGDGMVKASIPKDLTPADLDREQIEVLLRQKTEGPDK
VGLHPETGEPIYLLIGSYGPYVQLGDATEEQPKPKRASLPKGVSPEQVTLEMAVGLLSLP
RTLGTHPETGARIQAGLGRFGPYVVHDQGKEGKDYRSLKAGDDVLSVTLERAIELLAEPK
RGRGSRSSRSKAPLRELGAHPEDGEAINVYEGPYGHYIKHGKTNAGIPEGETVESITLEK
ALELLAAKEGTKKKGTRKSSSTKTAGQKTTKTAAKKESSKTGTKTSTRSSTKSTRKKSSS
TS
Download sequence
Identical sequences K9S7F9
gi|428224649|ref|YP_007108746.1| WP_015171261.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]