SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428224653|ref|YP_007108750.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224653|ref|YP_007108750.1|
Domain Number 1 Region: 57-162
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.09e-27
Family Pentapeptide repeats 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428224653|ref|YP_007108750.1|
Sequence length 187
Comment pentapeptide repeat-containing protein [Geitlerinema sp. PCC 7407]
Sequence
MLSRLLSRFFRRFLSPALQSSIFEPLLPKGAAIALIAALFWLAAAPAQADWQHPMSYSNA
ELTGRDFSGQTLQAFEFSNANLERANFEGADVRGGVFSASVLTDANLQGANLTNALMDQA
NLTRADLRGAILSEAILLGSTFAETAIAGADFSDAILDGAQIKALCQRAEGVNPVTGLST
RESLGCR
Download sequence
Identical sequences K9S666
WP_015171265.1.54702 gi|428224653|ref|YP_007108750.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]