SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428224743|ref|YP_007108840.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224743|ref|YP_007108840.1|
Domain Number 1 Region: 30-233,334-395
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.42e-35
Family FAD-linked reductases, N-terminal domain 0.066
Further Details:      
 
Domain Number 2 Region: 422-505
Classification Level Classification E-value
Superfamily ISP domain 1.22e-24
Family Rieske iron-sulfur protein (ISP) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428224743|ref|YP_007108840.1|
Sequence length 507
Comment FAD dependent oxidoreductase [Geitlerinema sp. PCC 7407]
Sequence
MSGLSGKPVSYWIDSTPETDYPGLMGDIEVDVAVVGGGIVGITAALLLKRAGKKVALIEA
DQIVQGTTGYTTAKLTSLHRLVYADLVQQLGEDKARLYGESNQAAIAFVADLVAQEQIDC
DFSRQSAYTFATTEKDLKQVRSEVEAAQKLGLPADFVTETSLPFPVLGAVRFADQAQFHV
RKYLLHLAAQIPGDGSHVFEQTRAVSLEGENPCSVVTDRGTVRAQDVILATHLPFRDEGL
YFAKSFPRRSYLVGAPIDPAIAPQGMFIGAGEDYHSIRTTPHEGGTLLIVGGEGHKTGEK
EDTETCYRRLEDYMRQQFGVEPTYRWSTQDIVSFDKLPYIGRLTPLHQHVYVATGFSLWG
MSKGTLSAMILSDLILGRPNPWASLYDSLRATPFVSKKSIQENIDVAAHWIGDRFKGLTD
HSLQDLQPGEGRLVTIDGDRIAASRDEQGNLHTVSPICPHLACLVSWNNAEQSWDCPCHG
SRFSCDGKILEGPAVEGLAPKSVEVKA
Download sequence
Identical sequences K9S6G8
WP_015171355.1.54702 gi|428224743|ref|YP_007108840.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]