SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428224902|ref|YP_007108999.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224902|ref|YP_007108999.1|
Domain Number 1 Region: 126-216
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.62e-18
Family Middle domain of MutM-like DNA repair proteins 0.0011
Further Details:      
 
Domain Number 2 Region: 2-125
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 7.98e-17
Family N-terminal domain of MutM-like DNA repair proteins 0.0000214
Further Details:      
 
Domain Number 3 Region: 236-271
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000399
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428224902|ref|YP_007108999.1|
Sequence length 273
Comment DNA glycosylase/AP lyase [Geitlerinema sp. PCC 7407]
Sequence
MPEGPEIRRAADQVERAIARQPLTEIFFAFEHLKPYETKLVTQEIRGVETKGKGMLICFA
QGLNIYSHNQLYGQWMVRRAQDYPPTNRQLRLAIHTAQKSALLYSASDIEVLADAELATH
SFWGRVGPDVLNPETTPEQVRDRLLAPEFRRRRLTTLLLDQHFLAGLGNYLRSEVLFVAR
VHPARRPLDCTPDQMARLAEGAIALPRQSYETGGITNDLTLAQSLKAAGQPRRLYRHWVF
GRDGQPCFVCETPIEKIDAGGRRCYYCPQCQSA
Download sequence
Identical sequences K9S5Q1
WP_015171514.1.54702 gi|428224902|ref|YP_007108999.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]