SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428225025|ref|YP_007109122.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428225025|ref|YP_007109122.1|
Domain Number 1 Region: 7-196,350-407
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.35e-45
Family HI0933 N-terminal domain-like 0.00065
Further Details:      
 
Domain Number 2 Region: 188-353
Classification Level Classification E-value
Superfamily HI0933 insert domain-like 2.09e-43
Family HI0933 insert domain-like 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428225025|ref|YP_007109122.1|
Sequence length 409
Comment hypothetical protein GEI7407_1579 [Geitlerinema sp. PCC 7407]
Sequence
MVQTDEPVIVIGGGAAGFFGAIACAEAHPDRHVILLEAGQQPLGKVRISGGGRCNVTHAC
FEPGALVQNYPRGGKALRGPFTRFQPKDTVAWFQRRGVTLKTEADGRMFPVTDSSETIVE
CLWQGARRSGVEIRLGSPVVAVEPQAAGFEVALRSGDRLRCDRLLLATGSQPQGHRIAQS
LGHHIEPPVPSLFTFNVPDPALRALAGVALDAAHLRLSLGTQKFEQTGPLLVTHWGLSGP
AVLKLSAWAARSLHECRYQTTLQINWLPGENLETARQRLLEARSQMPQRTLSAHRPVALP
RRLWDYLLGRAQLQLDARWAELSNKSLNHLALELVQGQYPIRGKSTFKEEFVTCGGVSLK
EVNFKTLESRLCPGLYFAGEVLDIDGVTGGFNFQSAWTTAWLAGQAMGN
Download sequence
Identical sequences K9S7D6
gi|428225025|ref|YP_007109122.1| WP_015171637.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]