SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428225139|ref|YP_007109236.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428225139|ref|YP_007109236.1|
Domain Number 1 Region: 62-199
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.48e-26
Family Filamentous hemagglutinin FhaB, secretion domain 0.0054
Further Details:      
 
Domain Number 2 Region: 352-530
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000102
Family Filamentous hemagglutinin FhaB, secretion domain 0.051
Further Details:      
 
Domain Number 3 Region: 552-678,719-744
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000785
Family Filamentous hemagglutinin FhaB, secretion domain 0.05
Further Details:      
 
Domain Number 4 Region: 655-817
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000816
Family iota-carrageenase 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428225139|ref|YP_007109236.1|
Sequence length 990
Comment filamentous hemagglutinin family outer membrane protein [Geitlerinema sp. PCC 7407]
Sequence
MIQRSPLRIFLLWRATAILAGMSFLLVHPCTAQVLPDSSLGAERSVITPEFDPSSGQVDI
ITGGAQRGTNLFHSFQEFNIGGLQRVYFASPGGVENILSRVTGPTSSTILGTLGVLGDAN
LFLINPNGIVFGPDASLDLRGSFTGSTAQGIKFADGTEFKADNAASTPLLTITVPTGLQF
YGTEGDILVQTGQVVSLNSFTETSDVGEGFDSNSIINDPRSGETFDAISGSLSREGDVDL
YPLFLQKGEPFVASTVAGTNLNTELFLFDSRGFGIAANNDSVGIQSTVPLYEPFIPDRSG
IYYLGISNYPNQPISEQGSIFDFGENPRGPGASMPLSGWDGTPSPAIRSSTGPYTIKLGP
RPNGLQVRPGKSLAFIGREIRIEGGRLEAPGGRIELAGISGAGVVEIVQQGQNVSLSIPE
GITRGNVDLANDAVISVAADQGGSITLYAQEVNLSDSSLIAGISPGLGEEGLQSGGISIQ
AARAVTLDESSVVNDIAPDARGNGGGIRISTGSLSIMNGSGLYSRVFGEGNAGDIQILAR
DDVRLDYSLSVSAVAPFGKGQGGDIQIDANSLFVTNIGQLVALTQGEGNAGNVIINARDT
VLFDGKDSRLPLASSAFSSVGSSSIEGRNARGQGGDIRISARAVVVANGGRLLANTNAFG
DAGNISLYARDSIRFEGGSEASSNVSSMARGNGGTINVIAGDSLSVQRGSKLEVSSSGAG
LAGSLSAEAETIQLSDGGVISANTTSGGGDINLRSPLIILRRNSSITTNATGTATGGNIA
VDAGFVVSAPNENNDIIANGFEGSGGQVRLAAEKTFWIDLRSREDLQLLLGTTDPAKLDP
RLLSTNDVTAFSQANPSIDTGRVMLQTPDLDPTRGMTALPENLVDPGDLVTATCSVNQRS
SFAMTGRGGIPEDPRQPLVGQVLWQDGRSGDRKERSSTPPGPMSSSSPIVEAQSWMIDRD
GKVTLVAAQPDDRRETALRRQGCAVSQTSP
Download sequence
Identical sequences K9S8U5
gi|428225139|ref|YP_007109236.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]