SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428225183|ref|YP_007109280.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428225183|ref|YP_007109280.1|
Domain Number 1 Region: 332-391
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.00000000000000196
Family TonB 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428225183|ref|YP_007109280.1|
Sequence length 580
Comment outer membrane transport energization protein TonB [Geitlerinema sp. PCC 7407]
Sequence
MSLSEVCAQQHDREQAALRKVILWGLLGSVGVHLVAFALSYLGIWQRPVTAEITPLEIIV
AEPTEPVLPEPPPEEPLEPAELGSETFDPEVPSLDAAPASDASAVALDAAPAADIVPVAT
SEPAAPASEPEAAPLPEEPEVAEALPEPPVPEDVAEPAAPEPEPVEEIAEETPLEEPEAA
AETQAASEVTEPPKPEPEAPKTPAAPAESQPEAPEEPRVAATAPDPSQRDRLRSFLRGLR
DRETSAARPGPAAQSATAQGSSTAANASRSESGNGQGDAPGGSGTVTAAGSGTRPGNTNT
SSGNGTGDRPSSGAGQETRGGGSRTVACEDCVEPEYPESAVEAGIEGQPLVNVEINADGS
VRSVVLTRSSGNAAIDRAAIEAAQRSRFQPVEGGASVPIEYDLNIEGSERNRAARERGER
RSVEIPTPTTAESAPPEPAETATDPAPEPVAPPSNDAPAPETPSATPTPETTPTPAIEEP
IPTSEPSEPEPIPQPEPQPEPLPEVEPVPESEPLLPEPIPEPIPEPIPEPIPEPMPEPEP
IPEPLPEPEAIPEEPEPAPVEAFPEPALPEADLPPSEEVL
Download sequence
Identical sequences K9S7N9
WP_015171794.1.54702 gi|428225183|ref|YP_007109280.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]