SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428225211|ref|YP_007109308.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428225211|ref|YP_007109308.1|
Domain Number 1 Region: 22-281
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.34e-24
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428225211|ref|YP_007109308.1|
Sequence length 676
Comment fumarate reductase/succinate dehydrogenase flavoprotein domain-containing protein [Geitlerinema sp. PCC 7407]
Sequence
MTMRRSWLRLTLVTLLFNSLIPPAVAAPPRSPDQTLTCDLLVAGGGLAGAAASYEALLDG
RTVCLTEITDWVGGQISSQGTSALDERTTQRAQLFYSRGYLALRDRIEKEYGKLNPGRCW
VSESCFLPEDGHEVLMSLLKDAARKGKGTLRWFPNTVIKELDLNGSQIAGAIAIQHQPAA
GAPPLNTFPLSETIEDAYTYANSDRLEKSIVRFQPSPPKGDRPAPQAWYVIDATETGEII
ALADVPYRLGIDPLSAREPSSSSVDGDPYCPQGFTYTFAMEHTEEPQDHPEPSFYQRYAP
YYSYELPRLASFPLVFTYRRIWSPGRDKEQPEKMTFGGLTFIPPKPGDISMQNWTWGNDY
RPGTAQDNLIYTRQQLEATGQLAPGGWMGGLRTETLAAGEEHAKGYFHWLVAGTTDSQLG
PDVKQPEPNNRFLAGFDAPMDTAHGLSKYPYMREGRRILGRPAWGYPEGFYISEIDISRR
DYSDEYYRETLPPDMYRNLRASLAGLEAGSILSGQVDPEQTTRRTRSTIYPDAVGIGHYA
IDFHPCMTESPAEAPGNTEREGERRGAGQAYPFQIPLRSLIPQKVDNLLVAGKSIATSHI
AAAAYRVHSFEWSSGAAAGTTASFALERGVVPYQLVDELPRREPELEALRRRLEQDGNPT
AFPDTSIFNLDWDDWR
Download sequence
Identical sequences K9S8I1
gi|428225211|ref|YP_007109308.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]