SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428225319|ref|YP_007109416.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428225319|ref|YP_007109416.1|
Domain Number 1 Region: 27-200,256-392
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.32e-31
Family Tandem AAA-ATPase domain 0.0074
Further Details:      
 
Weak hits

Sequence:  gi|428225319|ref|YP_007109416.1|
Domain Number - Region: 598-636,674-713
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00502
Family HD domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428225319|ref|YP_007109416.1|
Sequence length 830
Comment CRISPR-associated HD domain-containing protein [Geitlerinema sp. PCC 7407]
Sequence
MQSYADWFCKVTGKPPFPYQEGLAIADDWPLVLSAPTGAGKTAAVVVAWLWKCFCESSRR
ASTPRRLVYCLPMRTLVEQTYSAIEKWLENAELQQEVGLHLLMGGAVSHRWDDKPEQHCI
LVGTQDQLVSRALNRGYAMSRNKWPIHFALLNNDCLWVMDEVQLMGAALRTTAQLQGLRE
KFGTYGMTRSLWMSATLDPGLLVTADHKPGSICVYGLTPAEEDAARSLAQSATNSAIASK
APENAIAVLAKCMAAQKPLRRAETVCASKGDQYGDKLAQEIAAAHQPGSLTLVICNRVAR
AQEVYEALKKYTAEPRTLIHSRFRAAERQSLNAQLREGLSGILVATQAIEAGVDISAQVL
FTELAPWSSMVQRFGRCNRYGEHLMGAAVYWIDIPDLTNKSTALPYDEESLEKARSLLEG
LQDVGISTLKTVPAPSEEIEGLVPRRHDLLQLFDTSTDLAGHDIDVSSFIREANETDVAI
AWREWDGSSPPANLDALQAPELCRVSLSMAGDFLKEIKKQKQAAWVRDGRKKWQEVKTLV
PGMTILVPCQVGGYDPHLGFTGKAGHTPAVPIEKAIEADQDDRDLLSQGATAFVELSQHS
LEVKAEIETLIQHFSDWELPAQSLSRAAHWHDSGKAHPFFQTRLTYNREAQQGETLWAKS
DHDFKDPADRYLAPDDRQGFRHELVSALLALQEQESFLLCYLVACHHGRARMSIQPRLIA
RTQAVKKPDPEQRAAAPRDPLVLSALGVHEGDRVHHQLPEIDLGGGLVIPSQDLSLECLR
FGESDTGPSWTARALDLLEEYGPFKLAFLETLVRIADWRGSAKHADYWVE
Download sequence
Identical sequences K9S9C7
WP_015171930.1.54702 gi|428225319|ref|YP_007109416.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]