SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428225384|ref|YP_007109481.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428225384|ref|YP_007109481.1|
Domain Number 1 Region: 35-331
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.65e-31
Family Filamentous hemagglutinin FhaB, secretion domain 0.0057
Further Details:      
 
Domain Number 2 Region: 948-1105
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000188
Family iota-carrageenase 0.053
Further Details:      
 
Domain Number 3 Region: 1125-1272
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000188
Family Filamentous hemagglutinin FhaB, secretion domain 0.052
Further Details:      
 
Domain Number 4 Region: 620-797
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000204
Family Filamentous hemagglutinin FhaB, secretion domain 0.048
Further Details:      
 
Domain Number 5 Region: 741-874
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000879
Family iota-carrageenase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428225384|ref|YP_007109481.1|
Sequence length 1462
Comment filamentous hemagglutinin family outer membrane protein [Geitlerinema sp. PCC 7407]
Sequence
MQFINFIACLNSLGKRQFFIAGILCFSLVLDTNQKALAQIQPDNSLGSENSVVSPTLQIR
GIPAVQIEGGAIRGDNLFHSFRAFNITEGTGAYFANPTGVLNIFSRVTGSDPSRIMGVLG
VLGDANLFLLNPHGILFGPQARLDITGSLSASTGDRWLFDNGYTFSASSSQASPLLTIST
PLGLQYGSVGSGRIMNAGTLSVGKDLSFVGGSVASSGQLNAPNGRVRVEAIAGDAEVRQL
RARSAMLSASQDLTLVDSQLLTQIDLSLQAGNTVKMRDSPQNPLQIQAGGKLSVQGDQAI
DIFALSHPESGLMAGGDLVLRSQNPVAGDAHYWAGGNFRIEQLDGTLGDLYSPYDPIIRA
SGDVSLSAYQGVSLHILAGGQVNIPRGVLITGADPDITRTINPFNNPTFRLPDGTLVNEA
SFNLPDGTPITINGSASPTLDIRAGTLATNGTDIDYGSGPAFILGPLPNIAAPATGADIN
IGDIVMQAPNGVIFLTNHYFPNPQLGGGDINIALNTIPTPPIPTGVGITSNGAGNNIRSL
TINARQAININAPIDLSSTTGDAGNARLLAKTGIVVNRDILSNSAGTGKAGTLDFQAPAV
TIQNGARVAADTTGPGNAGAIAIRNANQVTIRDGANVSVNTFGEGLGGRITVDARQLDLQ
NTGQLSAITGNPALPSNSGAGGAIELNVSDRVTLDRGFIFTSSNSLGRAGDLTVNTPQFT
AQGGSLISASSLRSGQAGTITLNAPNGSVEFIGNNRSEIAPGNVVVPTTLSLGAFGNGAA
GSLAITTGQLTIRDGAQVYGSVGAGSPRGGFAADVVVTASDSVRVAGTTPDGTLSSQLSA
DTFGSANAGILTINTPRLSVLGGGQISAGTTGSGEAGRLTVQSQQVQVSGQSNGGTPSRI
TFDSFGSGDAGGLTIQTSQLQVTQGGKISARAGGTGQGGVIDVMALGGLVQVDGVGSGLF
FDSQGTGNARGIKITTGDLQIRNGGEVTVSSSGTGNAGDIQVESASVAIADGGQLTATID
AGRGGNIGVRAEDFLLTRGGQLSVSSKITGNAGNIQIAADTIQVTDKAQLTASINSGQGG
NVSLDSRTLTLSNDALISVSGAESGTAGDVAVRAQQATVTQGGNLSATIRSGSGGNISLD
VEELNVSDNGQISVSSSELGNAGNIRVNSGKVAIANGGSLNATINSGQGGNISVITGELT
LANRGQISVSSNGSGDAGNIQVQADNIFMADGARIIATINSGQGGNISLIAKDSIRLRRD
SDIRTNALGSGNGGNLFLEAGGLIFAVLSEDSDIIANAPEGRGGDITARAAGIFTFNNFQ
GEETPLSDFLNYGQQNGALNVDTQNPQPVPPLDDRLVGPDITPACAPNPAISSSTTGVAQ
FYQAGQGGVNPGPGNTVGSGGVQVPWGNIGAESDDASFGATEAQLSAIGAATDWRRNAKG
EMVLVGPRSGSVLSFCQSGRRL
Download sequence
Identical sequences K9S9H6
gi|428225384|ref|YP_007109481.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]