SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428225490|ref|YP_007109587.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428225490|ref|YP_007109587.1|
Domain Number 1 Region: 173-409
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.69e-24
Family Pectate lyase-like 0.061
Further Details:      
 
Domain Number 2 Region: 416-588
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000154
Family Galacturonase 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428225490|ref|YP_007109587.1|
Sequence length 961
Comment Polymorphic membrane protein Chlamydia [Geitlerinema sp. PCC 7407]
Sequence
MFSTQHPMNSYPSTHFVFVDAALDAPQHLVEGLLPKGHVTFLTPDRDGVEQIAEVLDQAE
RVEAVHIFSHGAPGRLFLGTSVLSLENEAFWGDRLRRSFERATASAVLVLYGCNVAATAL
GSAFVQELRSRLGVQVFASTSPTGSAARGGNWDLEDRLSGAIAPQILRPEAMASYPGLMA
VLTVTSTADSGPGSLRDTLAIAQSGDTIQFAPALANQTITLTSGQLTINKTLTLDGAGAP
GLTISGNNASRVFQITGGTTATLRNLIVANGRVSGADEATGAGGGIWTGENAVLTLENTQ
VNNSSAGFGGGVYISFRTQATIINSQFTGNDGSLANLERGGGAIATDSQCILTVQGSTFT
RNRGINGGAINSVSSQLLIEGSTFLANDTTPGAAGAATSGYGGAVFTDGANVAAPVGSIG
RTITIRTSRFEDNIGAGQGGGLFLYAYLPDRITVEDSVIVGNTVVRNASGDALGGGLRHG
NSELILRNTVFSQNLALQQGGGLWLGEASPVTISGSTFSENRADDSAGGGLGGGIFVATS
TYPVNISDTDVIYNQAGAYGGGFAAGSQAITLAGSVVAYNTANNPYNVQQQTTRQLLEGG
GNIQFPGPLTNDPNDVARITASAEIRDPGLLPYQDLGSLPGPSPLPTPLPTPGATPLVSG
FFNYVQHTQFFNLGGANVNFEQSFFQTQYLGVTQTTETTAPVSFRDLVLFGTNFGAPQVT
QTTTTTTTTTVLPNPATPLPLLKLFDETFYLSGNPDVAAAVGAGTFRSGYEHFVLFGQRE
GRDPSVLYDEDYYLSQNPDIAAGVASGAIESGFQHYLYFGQTEGRDPSAVFDEQTYLAAN
PDVADAVTGGVFVSGFQHYLQFGQAEGRGPQVMLFDEAYYLGAYRDVAVAILGGVFENAL
EHYVEFGQYEGRNPSAGFSEADYLQRYGDVAAAVDGGAFASGFQHYLQFGRVEGRVTIAS
A
Download sequence
Identical sequences K9S8P9
gi|428225490|ref|YP_007109587.1| WP_015172101.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]