SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428225675|ref|YP_007109772.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428225675|ref|YP_007109772.1|
Domain Number 1 Region: 7-66
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.46e-16
Family 7-Fe ferredoxin 0.0000621
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428225675|ref|YP_007109772.1|
Sequence length 81
Comment photosystem I iron-sulfur protein PsaC [Geitlerinema sp. PCC 7407]
Sequence
MSHSVKIYDTCIGCTQCVRACPTDVLEMVPWDGCKAGQIASSPRTEDCVGCKRCETACPT
DFLSIRVYLGAETTRSMGLAY
Download sequence
Identical sequences A0A1U7J583 A0A1Z4RRV4 K9EWQ5 K9S984
WP_006515950.1.17648 WP_006515950.1.18379 WP_006515950.1.3430 WP_006515950.1.53168 WP_006515950.1.54702 WP_006515950.1.80081 WP_006515950.1.9961 gi|428225675|ref|YP_007109772.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]