SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428225721|ref|YP_007109818.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428225721|ref|YP_007109818.1|
Domain Number 1 Region: 206-405
Classification Level Classification E-value
Superfamily PheT/TilS domain 6.8e-68
Family B3/B4 domain of PheRS, PheT 0.00000712
Further Details:      
 
Domain Number 2 Region: 492-705
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.01e-43
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000888
Further Details:      
 
Domain Number 3 Region: 36-193
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.37e-43
Family Myf domain 0.0022
Further Details:      
 
Domain Number 4 Region: 717-815
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 3.4e-29
Family Anticodon-binding domain of PheRS 0.0005
Further Details:      
 
Domain Number 5 Region: 417-499
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000000043
Family Domains B1 and B5 of PheRS-beta, PheT 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428225721|ref|YP_007109818.1|
Sequence length 816
Comment phenylalanyl-tRNA synthetase subunit beta [Geitlerinema sp. PCC 7407]
Sequence
MRISLNWLQELVDISLSPEALAETLTMAGFEVEDIEDRRTWADGVVVGKVLSREQHPNAD
KLSVCQVDVGAESGPLNIVCGAANVRADIYVAVATVGTYLPAIDLKLRPTKLRGVRSEGM
ICSLSEVGLEKDSEGIHIFGEAGLQPGADVRPLLGLEDVVLDLTSTANRADALSMVGVAR
EVAALTGATLRLPGADLEAIAQPEDASKLAVQVQEPKACPAYIGTMIENVNIQPSPEWLK
RRLQAAGVRPINNVVDVTNYVLLEWGQPLHAFDRDRLQQVAGAGALTLGVRFGRSDESLT
TLDSQKRKLQNQSLVITANDRPVALAGVMGGEDTEVHGGTTNLVLEAALFDSVAIRRSAR
SQGLRTEASTRYERGVNQAELEVAARRALALLLDLAGGTVVAQAIADSRPSQATWTRSIE
LRLERVNQVLGLVEVEDADPRELQPQEVERSLTALGCQVQPTDRKDVWSVTVPPYRYRDL
EREIDLIEEVARLYGYDKFCETLPDKSEAGYLSLEQELTRSLRAAFRGVGLTELMHYSLV
KPVHESQVTLANPLFAEYSALRTELIEGLVDAFQYNLEQGNGPLNAFEIGRVFWQDDLGF
HEMDALAGVMGGDASVGRWRRSGREQPMNWYEAKGLLESAFQRLGIKVEYQPDRRDSRLH
PGRTASLWIRGERLGTFGQLHPQLRRDRDLPDDVYIFTLSLDLLLGELSRDEALTPLFKP
FSSYPATDRDIAFFAPLAVSVVDLEKAIARAGGDLLESAELFDEYQGEGVPAGQRSLAFR
LVYRASDRTLTEADVEPVHQRVRELLSEKFSVSLRS
Download sequence
Identical sequences K9SA09
WP_015172331.1.54702 gi|428225721|ref|YP_007109818.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]