SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428225812|ref|YP_007109909.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428225812|ref|YP_007109909.1|
Domain Number 1 Region: 111-244
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 6.8e-26
Family GntR ligand-binding domain-like 0.017
Further Details:      
 
Domain Number 2 Region: 39-108
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.48e-18
Family GntR-like transcriptional regulators 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428225812|ref|YP_007109909.1|
Sequence length 251
Comment GntR family transcriptional regulator [Geitlerinema sp. PCC 7407]
Sequence
MARRLLTSLSYSLWILYTKIVYNIHMNLNDLAATVLQQQRSTPDLIADALRQAILHGIFQ
EGESLRQDQIATKFGVSRIPVREALRQLEVEGLVTFYTNRGATVSVLSPAEAQELCEIRA
ALETTALRVALPQLQAEDLQKAETLLAATDQATDVGRWSELNWEFHATLYAPAHRPRLMT
MLKAIHVNMDRYVRLQMSKMHYLERSQREHYQLLAACRQQDTPGAIALLEAHITEAGQQL
VAYLEQCPKGR
Download sequence
Identical sequences K9S8B4
WP_015172422.1.54702 gi|428225812|ref|YP_007109909.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]