SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428225936|ref|YP_007110033.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428225936|ref|YP_007110033.1|
Domain Number 1 Region: 57-199
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 3.92e-50
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000919
Further Details:      
 
Domain Number 2 Region: 3-56
Classification Level Classification E-value
Superfamily UBA-like 1.7e-18
Family TS-N domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428225936|ref|YP_007110033.1|
Sequence length 220
Comment translation elongation factor Ts (EF-Ts) [Geitlerinema sp. PCC 7407]
Sequence
MAEISAKLVKDLREKTGAGMMDCKKALKESGGDPVKAAEWLRQKGITSAEKKASRVAAEG
LVGSYIHTGGRVGVLVEVNCETDFVARREEFQTLVRNVAMQIAACPNVEYVKVSDIPAEV
AEREKQIEMGRDDLANKPENIREKIVVGRIEKRLKELALMDQPFIRDQSITVEELVKQAV
SQLGENIQIRRFVRFVLGEGIEKEESNFAEEVAAQTGGKL
Download sequence
Identical sequences K9SAJ4
WP_015172545.1.54702 gi|428225936|ref|YP_007110033.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]