SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428226004|ref|YP_007110101.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428226004|ref|YP_007110101.1|
Domain Number 1 Region: 10-182
Classification Level Classification E-value
Superfamily ADP-ribosylation 7.48e-58
Family Tpt1/KptA 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428226004|ref|YP_007110101.1|
Sequence length 187
Comment phosphotransferase KptA/Tpt1 [Geitlerinema sp. PCC 7407]
Sequence
MTENSPSLVTASKFMSLLLRHQPEAIGLSLDAQGWALIEDLVRLSQNSRSPLTREVILDV
VRTNSKQRFSVSEDGLRIRANQGHSISVDLGLAPIAPPEVLFHGTATRFLEAILAEGLRP
GSRQHVHLSADPATARQVGQRHGKPVVLVVASGAMHQAGHEFFRAENGVWLTAAVPPQYL
KVAVDSP
Download sequence
Identical sequences K9SB89
gi|428226004|ref|YP_007110101.1| WP_015172613.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]