SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428226397|ref|YP_007110494.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428226397|ref|YP_007110494.1|
Domain Number 1 Region: 16-211,312-402
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.41e-91
Family Bacterial dinuclear zinc exopeptidases 0.0000145
Further Details:      
 
Domain Number 2 Region: 195-313
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 3.93e-31
Family Bacterial exopeptidase dimerisation domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428226397|ref|YP_007110494.1|
Sequence length 403
Comment amidohydrolase [Geitlerinema sp. PCC 7407]
Sequence
MVATTAEAKSFHPAAIRPEIQALQDSLVQWRRHLHQRPELGFREVQTAAFVVSKLQEWGI
AHQSGIAQTGVVAVIEGDRPGPVLGIRADMDALPIQEANEVPYRSQHDGVMHACGHDGHT
AIALGLAHYLTHHRDRFQGTVKLIFQPAEEGPGGAKPMIEAGALQNPSLDAIIGLHIWNN
LPLGTVGVRSGPLMAAVELFRCTILGKGGHGALPHQTVDSIVVSAQIVNALQTIVARNVN
PIESAVVTVGEFHAGTAMNVIADTARLSGTVRYFSPQYDGFFKDRIEQTVAGICQGFGAQ
YDLDYWKLYPPVVNDPAIADLVRSVASAVVETPAGIVPECQTMGGEDMSFFLQEVPGCYF
FLGSANLSQNLAYPHHHPRFDFDETVLGVGVEIFARCVEAFCR
Download sequence
Identical sequences K9S9Z5
WP_015173006.1.54702 gi|428226397|ref|YP_007110494.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]