SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428226401|ref|YP_007110498.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428226401|ref|YP_007110498.1|
Domain Number 1 Region: 10-336
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.39e-119
Family TK-like PP module 0.000000000569
Further Details:      
 
Domain Number 2 Region: 341-530
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.09e-68
Family TK-like Pyr module 0.000000257
Further Details:      
 
Domain Number 3 Region: 536-668
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 8.25e-46
Family Transketolase C-terminal domain-like 0.0000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428226401|ref|YP_007110498.1|
Sequence length 668
Comment transketolase [Geitlerinema sp. PCC 7407]
Sequence
MAVATQSLDELCINAIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFMRFNPKNPTWF
NRDRFVLSAGHGCMLQYALLHLTGYDSVTLDDIKSFRQWGSRTPGHPENFETLGVEVTTG
PLGQGIANAVGLAMAEAHLAARFNKPDSTIVDHYTYVILGDGCNMEGISGEACSLAGHLG
LGKLIALYDDNHISIDGSTDVAFTEDVSKRFEAYGWHVLHVENGNTDLAAIQKAIEEAKA
VTDKPSMIKVTTTIGYGSPNKADTAGVHGAALGGDEVKATRENLGWNYEPFSIPDDVLGH
FRKAVERGASNEAEWQEALAAYRTKYPEEAKVFDRILTGELPEGWDKTLPTYTSQDKGVA
TRKHSEITLNALAPTLTELLGGSADLTHSNLTELKVSGDFQKGAYENRNIHFGVREHAMG
AICNGLALHTPGLIPYCATFLVFADYMRAAIRLSALSQVGVIYVMTHDSIGLGEDGPTHQ
PVETVASLRVIPNLLVMRPADGNETSAAYKVAVENRKRPTLLALSRQNLPNYDETSFEGV
AKGAYIISDSEGTPDIILIGTGSELQLCVEAAKQLRGEGKKVRVVSMPCCELFNEQSAEY
KESVLPKAVTKRVAVEAGSTFGWCRYTGSEGAVIGIDHFGASAPGNVCLEKFGFTVENVL
ATAKQVLG
Download sequence
Identical sequences K9SBW5
gi|428226401|ref|YP_007110498.1| WP_015173010.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]