SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428226436|ref|YP_007110533.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428226436|ref|YP_007110533.1|
Domain Number 1 Region: 105-383
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.8e-68
Family Alanine racemase-like, N-terminal domain 0.0027
Further Details:      
 
Domain Number 2 Region: 492-596
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.00000419
Family Eukaryotic ODC-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428226436|ref|YP_007110533.1|
Sequence length 669
Comment arginine decarboxylase [Geitlerinema sp. PCC 7407]
Sequence
MGGQSSPSSEQQQQPVTLEKTRQETRSPLQAMPLASTAPQKAWTIEDSEELYRIQGWGEP
YFSINAAGHVTVSPKGDRGGSLDLFELVESLKQRNLDLPLLIRFSDILEDRIERLNACFA
RAIARYNYPGSYRGVFPVKCNQQRHLIEDLVRFGRPHQFGLEAGSKPELMIALATLNTPD
ALLICNGYKDREYIETAILARRMGRPCIIVLEQVEEVGLAIEISRKLGIKPLLGVRAKLN
TRGVGRWGTSTGDRAKFGLTIPEIIHAVEELQAADMLDSLQLLHFHIGSQISAIGVIKDA
IREASQIYVELAALGANMQYLDVGGGLGVDYDGSKTNFHASKNYNMQNYANDIVAEVKET
CEERNLPVPTLVSESGRAIASHQSVLVFDVLGTNDAPSGDPGAIEESEHLIVRNLYETYL
AITEENYQEAYHDATQFKEEAISLFGFGYLSLRERARAERLYWACCEKILKICRQQEYVP
DDLEDLEKIMASIYYINLSVFQSAPDSWAIDQLFPILPIHRLDEEPNCRGTLSDLTCDSD
GKIDQFIDLRDVKSVLELHPLRSGEPYYLGMFLGGAYQEIMGNLHNLFGDTNTVHICLTP
KGYQIEHVVKGDRINEVLGYVQYDPEDLLESIRRQTEQALQEKQITLQEAQLLMQNYERS
LSSYTYLTS
Download sequence
Identical sequences K9SBZ3
WP_015173045.1.54702 gi|428226436|ref|YP_007110533.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]