SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428226465|ref|YP_007110562.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428226465|ref|YP_007110562.1|
Domain Number 1 Region: 37-181
Classification Level Classification E-value
Superfamily vWA-like 0.000000000000445
Family Integrin A (or I) domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428226465|ref|YP_007110562.1|
Sequence length 275
Comment hypothetical protein GEI7407_3040 [Geitlerinema sp. PCC 7407]
Sequence
MFHQRSRLEILPGLVAIAACGVTIGAQRPASAATLVPVNVELSLLVDVSPSINGEEYQRQ
MTGYGDAFRQLSAEFGAGTLGTVAVNLIQWSGPANQQQSIPWTLLNSPESALQFADAILA
LRRPTGFFGTDPGAAIEFATPLFSSNAYDGQRWVIDVSGDGVGDTRGARLARDNALAAGV
SAINGLPIVPLPTRPNQPQSGLERWYQDNLQGGEGSFILAARGFEDVGVAMEQKLRRELT
TLPPQPPSETVPEPSVLLGLGLLAGGLGLQRRSRA
Download sequence
Identical sequences K9SBH9
gi|428226465|ref|YP_007110562.1| WP_015173074.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]