SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428226607|ref|YP_007110704.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428226607|ref|YP_007110704.1|
Domain Number - Region: 43-100
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.000111
Family PDEase 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428226607|ref|YP_007110704.1|
Sequence length 282
Comment hypothetical protein GEI7407_3184 [Geitlerinema sp. PCC 7407]
Sequence
MYFNATELLIDDFVNKLKTGYRRTYGGWKPEYEDIIGWVGSMALENIANSDALYHNVEHT
ILVTLVGQEILRGKHIREGGVSPEDWLHFIISLVCHDIGYVKGVCRQDHDGKYATGKGDE
MVALPPGSSDAGLTPYHVDRAKLFVDERFGGHKLIDAELIKRNIELTRFPVPAAEDHQDT
VNYPGLIRASDLIGQLSDPRYLKKICALFYEFEETGVNKALGYRHPEDLRRNYPKFYWHG
VFPYVKTAVQYLLLTQQGKQIVANLHSNVFEVEHSEIAFGLS
Download sequence
Identical sequences K9SAJ3
WP_015173216.1.54702 gi|428226607|ref|YP_007110704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]