SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428226804|ref|YP_007110901.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428226804|ref|YP_007110901.1|
Domain Number 1 Region: 2-148
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 2.35e-36
Family N-terminal domain of MutM-like DNA repair proteins 0.00047
Further Details:      
 
Domain Number 2 Region: 143-232
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.18e-28
Family Middle domain of MutM-like DNA repair proteins 0.0012
Further Details:      
 
Domain Number 3 Region: 232-283
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.4e-16
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428226804|ref|YP_007110901.1|
Sequence length 288
Comment DNA-(apurinic or apyrimidinic site) lyase, Formamidopyrimidine-DNA glycosylase [Geitlerinema sp. PCC 7407]
Sequence
MPELPEVETVRTGLNQLTLLQPIQGGDVLLPRTVAHPVSSWEFLTALEGTQIQAWSRRGK
YLLASLVKAGSDRPAGWLGVHLRMTGQLLWLDREAPLQKHARVRLWLGGDRELRFVDQRT
FGRMWWVPPDCAPEQIITGLQGLGPEPFDAAFSVDYLMTQLRLRRGPIKSALLDQGLVAG
VGNIYADESLFLSQIHPQTPCAALTRSQVERLREALIGVLQASIAVGGTTFSTFLNVQGV
NGNYKGEAWVYGRTAAPCRHCGALIERLKLGGRSTHFCPACQPERSPR
Download sequence
Identical sequences K9SDK7
gi|428226804|ref|YP_007110901.1| WP_015173413.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]