SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428226853|ref|YP_007110950.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428226853|ref|YP_007110950.1|
Domain Number 1 Region: 2-376
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.99e-106
Family Cystathionine synthase-like 0.00000000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428226853|ref|YP_007110950.1|
Sequence length 394
Comment cysteine desulfurase [Geitlerinema sp. PCC 7407]
Sequence
MHRPIYLDCHATTPLDPRVFEAMRPFFLEHFGNPASVTHVYGWEAEAAVQRSREAIARAI
NAQPEEIVFTSGATEANNLAIKGVAEAYFAKGRHIVTVQTEHSAVLDPCRYLATLGFEVT
FLSVQPDGLIDLADLARSLRPDTVLVSVMAANNEIGVLQPLAEIGALCRDRGVLFHTDAA
QAIAKIPFDVQALHLDLMSLTAHKAYGPKGIGALYVRRRDPRVTLAPQLHGGGHERGRRS
GTLPTPQIVGLAEAIALGVADLSAEAQRITALRQRLWQRLETLPGLWLNGHPTQRLPGNL
NLSVADVDGQALLLGLQSTVAVSSGSACTSAKIEPSHVLRALGRSPELAFASIRFGIGRF
NTEAEIDQVAEAAIATIQALRDTPAIAPVDAVRP
Download sequence
Identical sequences K9SCH4
WP_015173462.1.54702 gi|428226853|ref|YP_007110950.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]