SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428227045|ref|YP_007111142.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428227045|ref|YP_007111142.1|
Domain Number 1 Region: 44-308
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.13e-42
Family Pectin methylesterase 0.082
Further Details:      
 
Weak hits

Sequence:  gi|428227045|ref|YP_007111142.1|
Domain Number - Region: 580-612
Classification Level Classification E-value
Superfamily Sporulation related repeat 0.000772
Family Sporulation related repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428227045|ref|YP_007111142.1|
Sequence length 615
Comment hypothetical protein GEI7407_3623 [Geitlerinema sp. PCC 7407]
Sequence
MSLLSRSVRVSAIASLLLSSGGVAIAVSSVGIPVVLGSLLAEGAIAQTQAATVLYVDPVR
GSDAGAGTAQAPLKTITQALAIAPTSSVIQLAPGTYSAASGETFPLRLQPGVTLQGSAES
QGQGIVIRGGGRFLSPTSAGQDIAILGANQAALIGVTVTNPNPRGYGLWIESSNPTVASN
TFTGNTHDGISVVGRSAPLIRGNHFVANGANGITLYGLSQAQVQENLFERTGFGVNVGQK
AAPTLLKNRIVGNEDGVVVQASSRPILRENVIEGNQRDGLVAIADSQPDLGTQAQPGSNT
FRNNGRLDVNVKASSQIVPAFGNQLVSSRVEGRVDLAGTTQVTPVPAIAAAPAPIVAQAA
DKSSLSARSFPVPTSLQSSPPVAPPPQVPVAAGPAPRAIPIPVAAPETAARPVTTSGRSL
PVPTVTPSVPVPAPVVPARTVPIQTAPAPTAAIEIPVTPPSRSVPVVERSPQPVQPAAVE
IPVLPPENADPTPQPATVAARPRSGALLPVPSARIPVGNAGNRARNVAIGASTPGGPPPP
PTQAQALGFQYRVVVATRSEADQARVRSLVPGAFRVFRGSQIFMQVGAYKTQAEADEMYQ
RVSSQGWQARIETTQ
Download sequence
Identical sequences K9SD52
WP_015173654.1.54702 gi|428227045|ref|YP_007111142.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]