SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428227058|ref|YP_007111155.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428227058|ref|YP_007111155.1|
Domain Number 1 Region: 1-331,452-490
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.34e-55
Family FAD-linked reductases, N-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428227058|ref|YP_007111155.1|
Sequence length 504
Comment all-trans-retinol 13,14-reductase [Geitlerinema sp. PCC 7407]
Sequence
MQDFDVIVVGSGIGGLVAGSLLARYGKTVLVCESHSLPGGAAHGFSREGFHFDSGPSFYC
GLSDPHSLNPLRQVLDVLGESLEAIAYDPLGHYHFPDVTLPIYGDAQRYRRAVAHITPEG
ASQLAHLEKKLLGLYEALRGIPTLALRSDWKLAPVLLGRYGLPLLKLLPYLTMVQSSVGA
VMQPLVQDPWVQRLIDLECFLLSGLKAEGTVAPEMAFMLGERSRSVIDYPVGGSGAIAWA
LVRGLERWGGRLRLNVHVERILVRDQRVTGVQLRSGENLLAPVVISNATLWDTYSHLLAP
DVLPESYRRAAMKTPAVESFMHLHLGIRAEGLESLTGHHVVMHDESWDLTRPGNTCMISI
PSVWDPHLAPSGYHVVHAYTLEDAAGWERSAQYDQRKRDRAQPLFRALEKVIPDLRSRIE
LELIGTPLTHARYLRRYQGTYGPAIAAGQGTFPSCYTPIQGLYRVGDSTLPGIGVPAVAA
SGILCANTLVEPEQTAELLALLPE
Download sequence
Identical sequences K9SD20
WP_015173667.1.54702 gi|428227058|ref|YP_007111155.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]