SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428223590|ref|YP_007107687.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428223590|ref|YP_007107687.1|
Domain Number 1 Region: 14-90,186-351
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 9.88e-50
Family Bacterial dinuclear zinc exopeptidases 0.004
Further Details:      
 
Domain Number 2 Region: 80-194
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 0.00000000000000113
Family Aminopeptidase/glucanase lid domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428223590|ref|YP_007107687.1|
Sequence length 357
Comment peptidase M42 family protein [Geitlerinema sp. PCC 7407]
Sequence
MTAANFDCLAYNRLFAIIEELVLCHSPSGVETEVDRWLENRFGQLGLEAWQDSAGNFVAR
IPGRDRGRAIAITAHKDEIGMMVKAVEPNGRIAVRRLGGAFPWVYGEGVVDLLGDRETVS
GILSFGSRHISHESPQKAQQEDKPVRWEDAWVETKRSPEDLAAAGIRPGTRAVIGKHRKR
PFRLQDYIASYTLDNKASIAILLALAEILETPAVDLYLVASAKEEVGALGALFFSQRQRL
DALIALEIIPLAPEYTIEGGSVPVVLAQDGYGIYDEDLTRQIRQAAEQMALPLQIATISG
FGSDGSIAMKFGHVARAACLGFPTDNTHGYEIAHLGAIAHCARILKGFCETVDLLCP
Download sequence
Identical sequences K9S392
WP_015170203.1.54702 gi|428223590|ref|YP_007107687.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]