SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428224504|ref|YP_007108601.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224504|ref|YP_007108601.1|
Domain Number 1 Region: 2-350
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.42e-77
Family TK-like PP module 0.0071
Further Details:      
 
Domain Number 2 Region: 290-480
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.16e-65
Family TK-like Pyr module 0.008
Further Details:      
 
Domain Number 3 Region: 493-624
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.49e-36
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428224504|ref|YP_007108601.1|
Sequence length 637
Comment 1-deoxy-D-xylulose-5-phosphate synthase [Geitlerinema sp. PCC 7407]
Sequence
MHLSEITHPNQLHGLSVYQLQQVARQIREKHLETVAKSGGHLGPGLGVVELTLALYQTLD
LDRDKVIWDVGHQAYPHKLITGRYNNFHTLRQKDGIAGYLKRGESKFDHFGAGHASTSIS
AALGMAIARDLKGEKFKVVAVIGDGALTGGMALEAINHAGHLPRTNLMVVLNDNDMSISP
NVGALSRYLNKMRLSPPMQFLSDNLEEQFKHLPFVGDSLSPELNRVKEGMKRLAVSKVGA
VFEELGFTYIGPVDGHNLEELITTFQQAHSQVGPVLVHVSTTKGKGYAIAEQDQVGYHAQ
SPFNLATGKAIPASKPKPPSYSKVFAHTLVKLAEDNPKIVGITAAMATGTGLDKLQAKLP
KQYMDVGIAEQHAVTLAGGLACEGMRPVVAIYSTFLQRAFDQVVHDVCIQNLPVFFCLDR
AGIVGADGPTHQGMYDISYLRCIPNMVLMAPKDEAELQQMLVTGVNYTDGPIALRYPRGN
GYGVPLMEEGWEALPIGKAEVLRQGDDLLLLGYGSMVYPAMQTAEILSEHGVEATVVNAR
FAKPIDDELILPLAQKIGRVVTMEEGSIMGGFGSGVAEALLDAGVVVPVMRLGVPDTLVE
HAKPEESKVELGLTPSQMAERILASMPTKVSTMSRQG
Download sequence
Identical sequences K9S706
gi|428224504|ref|YP_007108601.1| WP_015171116.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]