SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392410993|ref|YP_006447600.1| from Desulfomonile tiedjei DSM 6799

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392410993|ref|YP_006447600.1|
Domain Number 1 Region: 23-251
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.3e-31
Family Nuclease 0.057
Further Details:      
 
Domain Number 2 Region: 206-395
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.48e-23
Family Nuclease 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392410993|ref|YP_006447600.1|
Sequence length 722
Comment phosphatidylserine/phosphatidylglycerophosphate/cardiolipin synthase [Desulfomonile tiedjei DSM 6799]
Sequence
MEKEMVFRNKKHEGVLIEGRNCSSKRKARNVSFLIDGASYFTAFVRAVEQAKSTIYIAGW
DIDSRVSLLRRNSTEIESSRFGRFLDRVVAGKPDLRAYILLWDFSSLFMLDREFMPVFKL
GWQTHSRVQFMLDDRHPLGASHHEKIVVIDDSIAFVGGMDFGKGRWDTSEHIVNDPRRME
PDGNIHNPFHDVQILLDGDVAQALGDVFRRRWYRASGIRLVPPLPHDDYYWPAENAPDLE
DVTVAIARTDPGYVKPPPVHEIEHLYRDAIASASKFIYIENQYLTSDSVIHALADRLTDS
YGPEIVLILPHKSAGWLEEGTMDALRALALKRLLQADAFDRLGVYYPVLPGMETGDMVIH
SKVMVVDDDLVRIGSSNLSNRSMGLDTECDVALESSGEDRIRKKIGGLRNKLLAEHLGSS
PEIIEPNLARSQSLVKTIEHLRNSERSLKRLSPQVPEWIEAIAPTLNVVDPERPVNLEKM
IDDFVPEDLKMSHGPTLWKLAAMILVIAGLSVLWKWGPLRELITADSLAIWGGGLRQNDA
APLLVTLAYVAGTLVMVPITLLIAATALIFEPWLSFLYAVIGCLGAATVSYGIGRLVGRD
TIRNIAGNRVNKISKRLAQQNSLTIAAIRLLPIAPFPLVNLVMGASRVKFVNYVTGTLLG
LLPGIVIISLFAGSLKSAWENPNFKSLIVVLAIAAVSAATIFLVRKRWQRGPLSSAKRHG
AA
Download sequence
Identical sequences I4C6Z5
gi|392410993|ref|YP_006447600.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]