SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000005178 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000005178
Domain Number 1 Region: 22-180
Classification Level Classification E-value
Superfamily alpha-ketoacid dehydrogenase kinase, N-terminal domain 1.01e-58
Family alpha-ketoacid dehydrogenase kinase, N-terminal domain 0.000000403
Further Details:      
 
Domain Number 2 Region: 200-376
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.2e-29
Family alpha-ketoacid dehydrogenase kinase, C-terminal domain 0.00000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000005178
Sequence length 412
Comment PDK4 (Homo_sapiens) pyruvate dehydrogenase kinase, isozyme 4
Sequence
MKAARFVMRSAGSLSSAGLVPREVELFSRYSPSPLSMKQLLDFGSHNACERTSFAFLRQE
LPVRLANILKEIDILPDRLINTSSVQLVKSWYIQSLMDLVEFHDKSPDDQKALSDFVDTL
IKVRNRHHNVVPTMAQGIIEYKEACTFDPVTNQNLQYFLDRFYMNRISTRMLMNQHILIF
NDEKTGNPTHIGSIDPNCDVATVVQDAFDCSKMLCEQYYLTSPEMKLTQVNVKSPGQAIN
IVYVPSHLHHMLFELFKNAMRATVEHQENCPSLAPIEVIVVLGKEDLTIKISDRGGGVPL
RIIDRLFSYTYSTAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNLYSLSGYGTDA
IIYLKALSSESIEKLPVFNMSAFKHYQMSSEADDWCIPSKEPKNLAKQKVAM
Download sequence
Identical sequences G5AJS6
HGL_H00000005178 XP_004862772.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]