SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000164024 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000164024
Domain Number 1 Region: 1304-1530
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.52e-42
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 430-542
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-28
Family Cadherin 0.00045
Further Details:      
 
Domain Number 3 Region: 846-958
Classification Level Classification E-value
Superfamily Cadherin-like 4e-28
Family Cadherin 0.00071
Further Details:      
 
Domain Number 4 Region: 737-852
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-28
Family Cadherin 0.0015
Further Details:      
 
Domain Number 5 Region: 535-640
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-28
Family Cadherin 0.00073
Further Details:      
 
Domain Number 6 Region: 213-316
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-25
Family Cadherin 0.00096
Further Details:      
 
Domain Number 7 Region: 946-1062
Classification Level Classification E-value
Superfamily Cadherin-like 1.26e-24
Family Cadherin 0.0012
Further Details:      
 
Domain Number 8 Region: 1547-1757
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.29e-24
Family Laminin G-like module 0.0067
Further Details:      
 
Domain Number 9 Region: 318-428
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-24
Family Cadherin 0.0011
Further Details:      
 
Domain Number 10 Region: 641-741
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-20
Family Cadherin 0.00086
Further Details:      
 
Domain Number 11 Region: 3582-3611,3673-3752
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000235
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 
Domain Number 12 Region: 1054-1156
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000799
Family Cadherin 0.01
Further Details:      
 
Domain Number 13 Region: 1791-1834
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000786
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 14 Region: 1755-1789
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000013
Family EGF-type module 0.019
Further Details:      
 
Domain Number 15 Region: 1885-1924
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0001
Family Laminin-type module 0.0086
Further Details:      
 
Weak hits

Sequence:  HGL_H00000164024
Domain Number - Region: 2348-2591
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000146
Family Rhodopsin-like 0.022
Further Details:      
 
Domain Number - Region: 1914-1987
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.000235
Family Hormone receptor domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000164024
Sequence length 3767
Comment CELSR3 (Homo_sapiens) cadherin, EGF LAG seven-pass G-type receptor 3 (flamingo homolog, Drosophila)
Sequence
MDLEVQASGKRKRETGEGLGSLLCWRPEFSCGQTGTFRRGGLSPEALSSGTPSLGSTLPL
PSDFLAQPGGLQPVSFQRLARRSARKRVGTLRCCEELWGSGRRRQGERAGTAGEDRAFPR
WDCLPGVGESGRGLDSAPLEARTAPTSGSAPGELRTAPRRLRPGSAFRRRFLPQRPGPRP
PGLSTPLLLQASPEAWKTASANRARSRRAANRHPKFPQYNYQTLVPENEAAGTAVLRVVA
QDPDSGEAGRLVYSLAALMNSRSLELFSIDPHSGLIRTAAALDRESMERHYLRVTAQDHG
SPRLSATTMVAVTVADRNDHSPVFEQAQYRETLRENVEEGYPILQLRATDGDAPPNANLH
YRFVGPPAARTAAAAAFEIDPRSGLISTSGRVDREHMESYELVVEASDQGKEPGPRSATV
RVHITVLDENDNAPQFSEKRYVAQVREDVHPHTVVLRVTATDRDKDANGLVHYNIISGNS
HGHFAIDSLTGEIQVVAPLDFEAEREYALRIRAQDAGRPPLSNNTGLASIQVVDINDHTP
IFVSTPFQVSVLENAPLGHSVIHIQAVDADHGENARLEYSLTGVAPDTPFVINSATGWVS
VSGSLDRESVEHYFFGVEARDHGSPLLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDA
AVGTSVVSVTAVDRDANSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKL
VLTASDRALHDHCYVHINITDANTHRPVFQSAHYSVSMNEDRPVGSTVVVISASDDDVGE
NARITYLLEDNLPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDNGIPQKADTTYVEV
MVNDVNDNAPQFVASHYTGLVSEDAPPFTSVLQISATDRDAHANGRVQYTFQNGEDGDGD
FTIEPTSGIVRTVRRLDREAVPVYELTAYAVDRGVPPLRTPVSIQVTVQDVNDNAPVFPA
EEFEVRVKENSIVGSVVAQITAVDPDEGPNAHIMYQIVEGNIPELFQMDIFSGELTALID
LDYEACQEYLIVVQATSAPLVSRATVHVRLIDQNDNSPVLNNFQILFNNYVSNHSDTFPS
GIIGRIPAYDPDVSDHLFYSFERGNELQLLVVNQTSGELRLSRKLDNNRPLVASMLVTVT
DGLHSVTAQCVLRVVIITEELLANSLTVRLENMWQERFLSPLLGHFLEGVAAVLATPTED
VFIFNIQNDTDVGGTVLNVSFSALAPRGAGTGAAAPWFSTEELQEQLYVRRAALAARSLL
DVLPFDDNVCLREPCENYMKCVSAGRCVPGVCRNGGTCTDAPHGGFRCQCPAGGAFEGPR
CEVAARSFPPSSFVMFRGLRQRFHLTLSLSFATVQPSGLLFYNGRLNEKHDFLALELVAG
QVRLTYSTGESNTVVSPTVPGGLSDGQWHTVHLRYYNKPRTDALGGAQGPSKDKVAVLSV
DDCNVAVALQFGAEIGNYSCAAAGVQTSSKKSLDLTGPLLLGGVPNLPENFPVSHKDFIG
CMRDLHIDGRRVDMAAFVANNGTLAGCQAKLHFCDSGPCKNNGFCSERWGGFTCDCPVGF
GGKDCRLTMADPYHFRGNSTLSWDFGSDMAVSVPWYLGLAFRTRAMQGVLMQVQVGPHST
LLCQLDQGLLSVTVTRGSIRAAHLLLDQVTVSDGRWHDLQLELQEEPGGRQGHHVFMVSL
DFSLFQDTMAVGTELHGLQVKHLHVGGLPPSSKEEAPQGLVGCIQGVWLGSAPLGSPALL
PPSHRVNVEPGCIVTNACSSGPCPPHANCQDLWQTFTCTCQPGYYGPSCVDACLLNPCQN
QGSCRHLPGAPLGYTCDCLGGYFGHHCEHRMDQQCPRGWWGSPTCGPCNCDVHKGFDPNC
NKTNGQCHCKEFHYRPRGSDSCLPCDCYPVGSTSRSCAPHSGQCPCRPGALGRQCNSCDS
PFAEVTASGCRVLYDACPKSLKSGVWWPQTKFGVLATVPCPRGAQGAAVRLCDEDQGWLE
PDLFNCTSPTFRELSLLLDGLEQNKTALDTVEAKKLAQRLREVTGHTDYYFSQDVRVTAR
LLAYLLAFENHQQGFGLTATQDAHFNENLLWAGSALLAPETGDLWAALGQRAPEGSPGSS
GLVRHLEEYAATLARNMELTYLNPVGLVTPNIMLSIDRMEHPSSTRVTRRYPRYHSNLFR
GQDAWDPHTHVLLPSQSPWPSPSEALPTGSGMENSTSSSAVPPPAPPEPQPESSFSIVIL
LVYRTLGGLLPAQFQAERRGARLPQNPVMNSPVVSVAVFHGHNFLRGVLESPISLEFHLL
QTTNRSKAICVQWDPPGLEDQHGMWTARDCELVHRNGSHARCRCSRTGTFGVLMDASPRE
RLEGDLELLAVFTHVVMAVSVAALVLTAVVLLSLRSLKSNVRGIHANVAAALGVAELLFL
LGIHRTHNQLVCTVVAILLHYFFLSTFAWLLVQGLHLYRMQVEPRNVDRGAMRFYHALGW
GVPAVLLGLAVGLDPEGYGNPDFCWISIHDPLIWSFASPVVLVIVMNGTMFLLAARTSCS
TGQREAKKTPVLTLRSSFLLLLLVSASWLFGLLAVNHSILAFHYLHAGLCGLQGLAVLLL
FCVLNADARAAWTPACLGRKAGPEETRPAPGMGPGAYNNTALFEESGLIRITLGASTVSS
VSSARSGRTQDQDSQRGRSYLRDNVLVRHGSAADHTDHSLQAHAGPTDLDVAMFHRDAGA
DSDSDSDLSLEEERSLSIPSSESEDNDRARGRFQRPLRRAAQSERLLTHPKDVDGNDLLS
YWPALGECEAGPCALQTWGSERRLGLDTSKDAANNNQPDLALTSGDETSLGHAQRQRKGI
LKNRLQYPLVPQTRGAPELSWCRAATLGHRAVPAASYGRIYAGGGTGSLSQPASRYSSRE
QLDVLLRRQLSREQLEELPVPVLHPLSRPGSQEYLDTAPGHPEPRDRGSTLPRRQPPRDY
PSVMAGRFGSRDALDLGAPREWLNTLPPVRRTRDLDPQHPPLPLPPQQQLSRDPLLPSRP
LDPLSRSSNSRERLDQGPSQHPSREALGPPLPLLRAREDPASGPSHGPSTEQLDILSSIL
ASFNSSALSSSTPSGPHTTATPSATASALGPSTPHSATSHSISELSPDSECSHSRAHGYL
LKYLPVLGWLPHYRVREWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPVFGLYSSFYPVF
VYFLFGTSRHISVGTFAIMSVMVGSVTESITQDEDFQQNTNSTVSARVQLASTLSVLVGL
FQVALGLVHFGFVVNYLSEPLVRSYTTAASVQVFVSQLKYVFGLQLSSRSGPLSLIYTFL
EVCWNLPKSVVGTVVTAVVAGVALVMVKILNDKLHRHLPLPIPGELLTLIAATGISYGVN
LRNRFEVDTVGTIPTGLIAPMIPNPQLFGKLVGHAFAIAVVGFAIAISLGKIFALRHGYR
VDSNQELVALGLSNFVGGFFQCFPVSCSMSRSLVQETTGGNTQVAGAVSSLFILLIILKL
GELFRELPKAVLAAIIIVNLKGMLKQFTDICTLWKANRVDLLIWVVTFVATILLNLDLGL
AVAIGFSLLLVVVRTQMPRYSVLGQVPDTDIYRDVAEYSEAKEIPGVKVFRSSATLYFAN
AELYSDTLKQRAASSNGTSVSISVDTSLGDIKGSGVEDSRVKVSPANELEDVVVSRQEDA
KAPDVSTLKALGLPRPDFHSLILDLGALSFVDTVCIKSLKNIFRDFREIEVEVYIAACHS
PVVTQLEAGCFFDASITKKHLFVSVHDAVTFALQHSRSGPNSPVLVS
Download sequence
Identical sequences G5AVL5
HGL_H00000164024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]