SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000202625 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000202625
Domain Number 1 Region: 171-489
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.7e-128
Family Transglutaminase core 0.00000000337
Further Details:      
 
Domain Number 2 Region: 27-170
Classification Level Classification E-value
Superfamily E set domains 1.29e-39
Family Transglutaminase N-terminal domain 0.00016
Further Details:      
 
Domain Number 3 Region: 522-633
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.07e-26
Family Transglutaminase, two C-terminal domains 0.00023
Further Details:      
 
Domain Number 4 Region: 636-731
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.05e-24
Family Transglutaminase, two C-terminal domains 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000202625
Sequence length 734
Comment TGM6 (Homo_sapiens) transglutaminase 6
Sequence
MTLLNSSREETALDWMLQLLGSGPTLQLLTRVRVTKVDWQQTRNGAAHRTREYSCCELVV
RRGQLFSIRLYLTGVLDREETLTLTVETGSQASEALHTKAVFQTAHLEVGDAWTAAKEAQ
TGNTVTVSLASPPDAVIGRYLLSARASSRHKHGDRKLGEFVLLFNPWCPEDDVFLASEEE
RQEYVLNDSGIIYRGVEKHIRAQGWNYGQFEEDILNICLSILDRSPSYQEDPATDVSCRH
NPVYVTRVVSAMVNSNNDRGVVQGQWQGKYSGGTSPLHWRGSVAILQKWFKGKYKPVKYG
QCWVFAGVMCTVLRCLGIPTRVVSNFNSAHDTDKNLSVDKYVDSFGRTLEDLTEDSMWNF
HVWNESWFARQDLGPSYDGWQVLDATPQEESEGMFQCGPASVTAIREGDIHLAHDGPFVF
AEVNADYITWLWHKDESQERVYSDTKKIGRCISTKAVGSDSRVDITSLYKYPEGSQKERQ
VYRKAMKKLLSVEAWGKRSQIQRASRHSLQHDDLLEPPTKPSITGKFKVLEPPVLGHDLK
LALSLASLTSQVLQVQVNLSGATILYTRRPVAEILHESHTVRLDPQEEKKIPITISYSQY
KENLTEDKKILLAAMCLVTKGEKLLVEKDITLEDFIIIKVLGPATVGVAVAVEVTVVNPL
SERVKDCVLMVEGSGLLQGQLSINIPTLQPQERALVQFSITPTRSGPRQLQVDLVSPHFP
DIKGFVIIHVAAAK
Download sequence
Identical sequences G5B4R6
HGL_H00000202625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]