SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000206765 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000206765
Domain Number 1 Region: 249-558
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.28e-116
Family Transglutaminase core 0.000000017
Further Details:      
 
Domain Number 2 Region: 97-248
Classification Level Classification E-value
Superfamily E set domains 4.9e-45
Family Transglutaminase N-terminal domain 0.0001
Further Details:      
 
Domain Number 3 Region: 572-683
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.4e-29
Family Transglutaminase, two C-terminal domains 0.00052
Further Details:      
 
Domain Number 4 Region: 684-783
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.54e-29
Family Transglutaminase, two C-terminal domains 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000206765
Sequence length 811
Comment TGM1 (Homo_sapiens) transglutaminase 1 (K polypeptide epidermal type I, protein-glutamine-gamma-glutamyltransferase)
Sequence
MMDSSRSDMGRWGGNPLQPPATPSPEPDRVWDRNRDRDRRRGGGARSFWARCCGCCSCRN
REDDDWGPEPSGSRNRGSSSWNRRPESRGSGVNAAGDGTVREGMLVVTRVDLLGSRSDQN
RRDHHTDEFEYDELIVRRGQPFYLVLFLNRPYESSDRMALELLIGNNPEVGKGTHVIIPV
DKGSSGGWKAHVTKASGQNLNLRVHTSPSAIIGKFQFTVRTRCEAGEFQLPLDPRNEIYI
LFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDACLYIL
DRRGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVEILLSY
LRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDENMKPLE
HLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESIKNGLV
YMKYDTPFIFAEVNSDKVYWQRQEDGSFKIVYVEEKAIGTLIVTKAISSNMREDITHTYK
HPEGSEAERKAVETAAAHGSKPNVYASRDSTEDVAMQVEAQDAVMGQDLTVSVVLTNRGS
NHRTVKLHLYLSVTYYTGVTGSIFKESKKEVALAPGASDRMTMPVAYKEYQPHLVDQGAM
LLNVSGHVKESGQVLAKQHTFRVRTPDLSLTLLGAAVVGQECEVQIIFKNPLPITLTKVV
FRLEGSGLQRPKVLNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDSPQLSQVHGVIQVD
VAPASGGGAFSEAGGDSRSGESIPMASRGGA
Download sequence
Identical sequences G5B280
HGL_H00000206765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]