SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000216277-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000216277-2
Domain Number 1 Region: 213-361
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.31e-62
Family Poly(A) polymerase, PAP, middle domain 0.0000000594
Further Details:      
 
Domain Number 2 Region: 17-210
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.2e-53
Family Poly(A) polymerase, PAP, N-terminal domain 0.0000000144
Further Details:      
 
Domain Number 3 Region: 364-494
Classification Level Classification E-value
Superfamily PAP/Archaeal CCA-adding enzyme, C-terminal domain 4.71e-40
Family Poly(A) polymerase, PAP, C-terminal domain 0.000000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000216277-2
Sequence length 736
Comment PAPOLA (Homo_sapiens) poly(A) polymerase alpha
Sequence
PVTTQGSQQTQLPPKHYGITSPISLAAPKETDWVLTQKLIETLKPFGVFEEEEELQRRIL
ILGKLNNLVKEWIREISESKNLPQSVIENVGGKIFTFGSYRLGVHTKGADIDALCVAPRH
VDRSDFFTSFYDKLKLQEEVKDLRVCKWEAFVPVIKLCFDGIEIDILFARLALQTIPEDL
DLRDDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDNFRLTLRAIKLWAKRHNIYSNILG
FLGGVSWAMLVARTCQLYPNAIASTLVHKFFLVFSKWEWPNPVLLKQPEECNLNLPVWDP
RVNPSDRYHLMPIITPAYPQQNSTYNVSVSTRMVMVEEFKQGLAITDEILLSKAEWSKLF
EAPNFFQKYKHYIVLLASAPTEKQRLEWVGLVESKIRILVGSLEKNEFITLAHVNPQSFP
APKENPDKEEFRTMWVIGLVFKKTENENLSVDLTYDIQSFTDTVYRQAINSKMFEVDMKI
AAMHVKRKQLHQLLPNHVLQKKKKHSTEGVKLTALNDSSLDLSMDSDNSMSVPSPTSATK
TSPLNSSGSSQGRNSPAPAVTAASVTNIQSPEVSVPQTNSSDSSGGTSSESIPQTATQPA
ISPPPKPTVSRVVSTTRLVNPPPRPSGNAATKISNTIAGVKRTSSPHKEESPKKPKTEED
ETSEDANCVALSGHDKTEAKEQLDTETNTTQSETTQTAASLLASQKTSSTDLSDIPALPA
NPIPVIKNSIKLRLNR
Download sequence
Identical sequences G5B4A1
HGL_H00000216277-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]