SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000220420 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000220420
Domain Number 1 Region: 147-463
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.25e-127
Family Transglutaminase core 0.00000000787
Further Details:      
 
Domain Number 2 Region: 3-145
Classification Level Classification E-value
Superfamily E set domains 8.75e-41
Family Transglutaminase N-terminal domain 0.00012
Further Details:      
 
Domain Number 3 Region: 618-716
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.41e-28
Family Transglutaminase, two C-terminal domains 0.00019
Further Details:      
 
Domain Number 4 Region: 505-616
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.71e-27
Family Transglutaminase, two C-terminal domains 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000220420
Sequence length 719
Comment TGM5 (Homo_sapiens) transglutaminase 5
Sequence
MAQGLEVALTDLRSSWNNVYHHTDDVSVDRLLVRRGQAFSIILYFRNRGFQPGLDNIIFV
VETGPLPDLAKGTRAVFGLGNQGGPGPWIALPEAPGPTSLEVSLCAPPMAAVGRYLLKVH
ISSFQGSVTAYKLGEFILLFNPWCPGDAVYLDSEPQRQEYVVNDYGFIYQGSKNWIRPCP
WNYGQFEENIIDICLELLDKSLNFQTDPATDCALRGSPVYVSRVVCTMINSNDDNGVLNG
NWSENYVDGINPAEWTGSVAILKQWHAAGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVIT
NFDSGHDTDGNLIIDEYYDNTGRILENKKKDTVWNFHVWNECWMARKDLPPGYGGWQVLD
ATPQETSNGLYCCGPASVRAIKEGEVDLKYDTPFVFSMVNADCMSWLIYGGKEQKLHQDT
TSVGNFISTKSIQSDERDDITESYKYGEGSPQERLVFQKALQKLKSERSHGTLRADSQPS
RPLSRSWDSPRSLDTPSLRPSDVVQVSLKFELLDPPNMGQDINFVLMALNMSSQFKDLRV
NLSAQSLLHDGSPLPTFWQDKAFITLSPEEERTYPCKIPYAQYSQYLSTDKLIRISALGE
EKSSPEKILVNKIITLTYPGITINVLGAATVNQPLSIQVIFSNPLSEPVEDCVLTLEGSG
LFKKQQRVLIGVLKPHHRATITLKTVPFKSGPRQIQANLRSNKFKDIKGYRNINVDFAL
Download sequence
Identical sequences G5BM43
HGL_H00000220420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]