SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000224862 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000224862
Domain Number 1 Region: 44-205
Classification Level Classification E-value
Superfamily RNI-like 1.53e-23
Family Cyclin A/CDK2-associated p19, Skp2 0.01
Further Details:      
 
Domain Number 2 Region: 5-56
Classification Level Classification E-value
Superfamily F-box domain 0.0000719
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000224862
Sequence length 240
Comment FBXL15 (Homo_sapiens) F-box and leucine-rich repeat protein 15
Sequence
MESPMEPSGVEQEPGAVRLLDLPWEDVLLPHVLSRVPLRQLLRLQRFSRAFRALVQLHLA
GLRRFDAAQVSPAPGDPGCPRLRRLSPAHCDWVDGLALRGPAGRCPALEELALTACRQLK
DEAIVYLAQRRGAGLRSLSLAVNANVGDTAVQELARNCPRLEHLDLTGCLRVGSDGVRTL
AEYCPALLSLRVRHCHHVAEPSLSRLRKRGVDIDVEPPLHQALVLLQDMAGFAPFVNLQV
Download sequence
Identical sequences G5CAH3
HGL_H00000224862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]