SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000228641 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000228641
Domain Number 1 Region: 92-165
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.63e-18
Family HLH, helix-loop-helix DNA-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000228641
Sequence length 240
Comment MYF6 (Homo_sapiens) myogenic factor 6 (herculin)
Sequence
MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQIPPEAGSDSSGEE
HVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRT
VANPNQRLPKVEILRSAITYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQEILEGADFL
RTCSSQWPSDHSRGLVITAKEGGASTDSSASSSLRCLSSIVDSISSEERKLPCLDEVVEK
Download sequence
Identical sequences G5BH16
HGL_H00000228641 XP_004867575.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]