SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000228644 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000228644
Domain Number 1 Region: 83-160
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.97e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0000812
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000228644
Sequence length 255
Comment MYF5 (Homo_sapiens) myogenic factor 5
Sequence
MDMMDGCQFSPSQYFYDGSCIPSPEGEFGDEFEPRVAAFGVHKAELQGSDEDEHVRAPTG
HHQAGHCLMWACKACKRKSTTIDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPK
VEILRNAIRYIESLQELLREQVENYYSLPGQSCSEPTSPTSNCSDGMPECNSPIWSRKNS
SFDSVYCPDVSNVYATDKSSLSSLDCLSSIVDRITSSEHPGLPLQEPASLSPVTSTDPQP
VTPGASSTRLVYHVL
Download sequence
Identical sequences G5BH15
XP_004867576.1.39548 HGL_H00000228644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]