SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000228936 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000228936
Domain Number 1 Region: 50-280
Classification Level Classification E-value
Superfamily ADP-ribosylation 9.59e-76
Family Ecto-ART 0.0000674
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000228936
Sequence length 311
Comment ART4 (Homo_sapiens) ADP-ribosyltransferase 4 (Dombrock blood group)
Sequence
PWISRCKWILLPATASPVMRMRLQGGQLALLLLLCGLQTPTGHAEVTIKVDFDLAPDSFD
DQYQGCSKQVMEELSQGDYFTEEIDAHKHYFRVWHKAHLTWLSREKALPKNMTDTHAVAL
LVYTSNSQVRSDFATAMASAARSPQQYKRSFHFKYLHYYLTSAIQLLRTQLSTKSHTLCY
EVHHGMKDIHFVANVGDTVRFGQFISTSLLREEAQKLGRKTLFTIFSCLGAPVQDFSLQK
EVLIPPYELFEVVNTSYHPNGNWLQLQSTGNLSIYNCQLLKASSEKCIPTPIVIASLYFL
ATVIISSKSRV
Download sequence
Identical sequences G5BV49
HGL_H00000228936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]