SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000231121 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000231121
Domain Number 1 Region: 31-91
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 7.07e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000231121
Sequence length 152
Comment HAND1 (Homo_sapiens) heart and neural crest derivatives expressed 1
Sequence
PPAAAVAAYGPDARPGQSPGRLEALGGRLGRRKGSGTKKERRRTESINSAFAELRECIPN
VPADTKLSKIKTLRLATSYIAYLMDVLAKDAQAGDPEAFKAELKKADGSRESKRKRELPP
HEGFPSALGPGEKRIKGRTGWPQQVWALELNQ
Download sequence
Identical sequences G5AY09
HGL_H00000231121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]