SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000231487-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000231487-1
Domain Number 1 Region: 52-112
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.31e-22
Family Skp1 dimerisation domain-like 0.0000473
Further Details:      
 
Weak hits

Sequence:  HGL_H00000231487-1
Domain Number - Region: 3-40
Classification Level Classification E-value
Superfamily POZ domain 0.000863
Family BTB/POZ domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000231487-1
Sequence length 141
Comment SKP1 (Homo_sapiens) S-phase kinase-associated protein 1
Sequence
MPSIKLQSSDEEIFEVDVEIASLNIKNVIQWCIHPKDDPPLPEYDENKEKRTDDIPVWDQ
EFLKVDQGTLFEHILAANYLDINGLLDVTYKTVANMIKGKTLEEIRKTFNISKTTLLKRR
KPRYARRTSGVKRSETLCLTL
Download sequence
Identical sequences G5AM82
HGL_H00000231487-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]