SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000231487-4 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000231487-4
Domain Number 1 Region: 45-120
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 5.36e-31
Family Skp1 dimerisation domain-like 0.0000093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000231487-4
Sequence length 123
Comment SKP1 (Homo_sapiens) S-phase kinase-associated protein 1
Sequence
MTLLLRVTRTKKIEQMISLNQWCTHHKDDPPPEGDENKENRTDDIPVWDQEFLKVDQGTL
VELILAANYLDIKGLLHVTCNTVANMIEGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWC
EEK
Download sequence
Identical sequences G5B2A4
HGL_H00000231487-4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]