SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000231790 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000231790
Domain Number 1 Region: 8-221
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.11e-51
Family DNA gyrase/MutL, N-terminal domain 0.0000201
Further Details:      
 
Domain Number 2 Region: 202-334
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.82e-32
Family DNA gyrase/MutL, second domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000231790
Sequence length 758
Comment MLH1 (Homo_sapiens) mutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli)
Sequence
MSLVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVVVKEGGLKLIQ
IQDNGTGIRKEDLEIVCERFTTSKLQSFEDLATISTYGFRGEALASISHVAHVTITTKTA
DGKCAYRASYSDGKMKASPKPCAGNQGTQITVEDLFYNITTRRKALKNPSEEYGKILEVV
GRYSIHNSGVSFSVKKQGETVADIRTLSSATIVDNIRSIFGNAVSRELIEVGCEDKTLAF
KMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGANSSRMYFTQTLLPGLAGSSGEIV
KSTPGVTPSSTSGSGDKVYAYQMVRTDSREQKLDAFLQPVSKALPSQPQAVDPGDKTDGS
SCKAGQQDEDMLEIPALGEVAAKSQNTEGDANKGALETAEKRAPTSSPGNPRKRHREDSD
VEMMESGSQKEMTAACTPRRRIINLTSVLSLQEEINERRHETLREMLQNHSFVGCVNPQW
ALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALGSPESGWT
EEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFIL
RLATEVNWDEEKECFESLSKECAMFYSIRKQYVSEESTLSSQQSEVSGSTLNPWKWTVEH
IIYKAFRLHLTPPKHFTEDGNVLQLANLPDLYKVFERC
Download sequence
Identical sequences G5BR58
HGL_H00000231790 XP_004857944.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]