SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000232424 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000232424
Domain Number 1 Region: 99-149
Classification Level Classification E-value
Superfamily Orange domain-like 2.22e-16
Family Hairy Orange domain 0.0022
Further Details:      
 
Domain Number 2 Region: 25-94
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000232424
Sequence length 279
Comment HES1 (Homo_sapiens) hairy and enhancer of split 1, (Drosophila)
Sequence
MPADIMEKNSSSPVAATPASVNATPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNE
VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGAGGPQHAP
FAPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKGFGGFQVVPAPDGQFAFLIPNGAFAHS
GPVIPVYTSSSGTSVGPNAGSPSSGPALTADSMWRPWRN
Download sequence
Identical sequences G5ALE8
HGL_H00000232424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]