SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000236166 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000236166
Domain Number 1 Region: 1-37,115-271
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000204
Family FAD/NAD-linked reductases, N-terminal and central domains 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000236166
Sequence length 291
Comment FMO6P (Homo_sapiens) flavin containing monooxygenase 6 pseudogene
Sequence
MGKKVAIAGAGIIGLAAIQCCLEEALSPLALRGAMMLEACRNSWSCPAKNISSSPCIAIS
MVVFRSPDCKAEKPPFHLSLPPLTEDRRQLCVKQDSDLTSAQCGLHTFSDLHKNFKDHPE
GGRASIYQSVFTNSSKEMMCFPDFPYPDDNPNDMHDSQLQEYIKTFAPEKNLLQYIQFEH
LRKEPVFNDELLSCILCGIVSIKPSVKEFTKTSAMFEDETVSEAIDSIIFATGYTYASPF
LYDDSIIKSKNNEVTLFKGIFPPLMEKLTLVVISLVQSLRGAIPIADLQAH
Download sequence
Identical sequences G5BGT5
HGL_H00000236166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]