SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000237316 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000237316
Domain Number 1 Region: 77-149
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.4e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000237316
Sequence length 179
Comment TCF21 (Homo_sapiens) transcription factor 21
Sequence
MSTGSLSDVEDLQEVEMLECDGLKVDSNKEFVTSNESTEESSNCENGSPQKGRGGLGKRR
KAPTKKSPLSGVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDT
LRLASSYIAHLRQILANDKYENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS
Download sequence
Identical sequences G5AS64 H0W7D6
HGL_H00000237316 10141.ENSCPOP00000018890 XP_003468495.1.53824 XP_004874889.1.39548 XP_008820323.1.79516 ENSCPOP00000018890 ENSCPOP00000018890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]