SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000238714 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000238714
Domain Number 1 Region: 69-216
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 6.07e-40
Family Poly(A) polymerase, PAP, N-terminal domain 0.00000114
Further Details:      
 
Domain Number 2 Region: 212-263
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.00000000000196
Family Poly(A) polymerase, PAP, middle domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000238714
Sequence length 528
Comment PAPOLG (Homo_sapiens) poly(A) polymerase gamma
Sequence
MGPRTVPTGASCAQCPLALRFGQGRAAQDKGSGGTCRARRSEAVAATRGARRFTARNTML
DSQRQQKHYGITSPISLACPKEIDHIYTQKLIDAMKPFGVFEDEEELNHRLVVLGKLNNL
VKEWISDVSESKNLPPSVVATVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERSDFFQ
SFFEKLKHQDGIRNLRAVEDAFVPVIKFEFDGIEVNPSDRYHLMPIITPAYPQQNSTYNV
STSTRTVMVEEFKQVYRQANNINMLKEGMKIEATHVKKKQLHQYLPAEILQKKKKQSLSD
VSRSSGGLQSKRSSLDSNCLDSSRDTDSGTPFNSPLSTNKPSKPESPRTGETERSSAEPA
AVIAEKPLSVPPAQGLSIPVIGAKVDSTVKAVSPPAVCTIPTVVGRNVIPRITTPHNPAQ
GQPHLNGISNMTKNVTTKRSHSPSIDGTPKRLKDIEKFIRLESAFKDSRNEDRKRKTMDA
VGESMPIPTIDTSRKKRLPSKELPDSSSPVPANNIRVIKNSIRLTLNR
Download sequence
Identical sequences G5C200
HGL_H00000238714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]