SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000241651 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000241651
Domain Number 1 Region: 81-150
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 7.46e-17
Family HLH, helix-loop-helix DNA-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000241651
Sequence length 224
Comment MYOG (Homo_sapiens) myogenin (myogenic factor 4)
Sequence
MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELGLSPETRGPLEDKGLGIPEH
CPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVE
ILRSAIPYIERLQALLSSLNQEERDLRYGGGGGPQPAVPSECSSHSASCSPEWGSALEFS
PNPSDHLLASDPTDAHNLHSLTSIVDSITVEDVSVAFPDETIPN
Download sequence
Identical sequences G5B370
HGL_H00000241651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]