SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000242261-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000242261-1
Domain Number 1 Region: 70-146
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.1e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000242261-1
Sequence length 164
Comment TWIST1 (Homo_sapiens) twist homolog 1 (Drosophila)
Sequence
MRCLLQVPSTSCAAFSTCTGILCPSPVCPAWSCPDSRRYSKKSSEDGSPTPGKRGKKPSP
SAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDF
LYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH
Download sequence
Identical sequences G5BHI1
HGL_H00000242261-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]